SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8PH54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8PH54
Domain Number 1 Region: 42-183
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000131
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8PH54
Sequence length 650
Comment (tr|A0A0K8PH54|A0A0K8PH54_STRAJ) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:GAP47222.1} KW=Complete proteome; Reference proteome OX=146537 OS=Streptomyces azureus. GN=SAZU_1959 OC=Streptomyces.
Sequence
MTDTTAFDWRSFLLRWSGEWADSLPDDETRGEDDETARRARWLGFPPASEERIAAMEERL
GRRMPPSYREFLKVSDGWRHAGGFVWLLAGTEDAHWHNNESGLADVFEEYLDEDAGPEER
RVTDIWRRGLQLDVESDVTHVLLDPEDVGEDGEWAVYTWASWLAEPPERHANFVEFMRDM
YREFHSLRAQGSDEEPVFVNDTTEKLDSLVQEARLEALRGGWERAGKALDEAKEYGRPRA
AGLGDQIRRLLGQTYMVYFEDLVTDPRYAPDLLPPLVAEHAAHSYRDDSTLTFHLRGAGD
DVLSLAHATLDQVGNGTYRYTAAGPFGEAVERARELARWGDTDGAWRTLRNAVPLWEPLG
PDHLAPLGWIADPVLGPLLTPERGRELLSTPRAGQAGEAPRPTAGLDPGGLAWLAEPDPG
NNRTSYRFVLVEGVEPEEMPGRLADGDDTVLNEPMTFWEARHSSLRNRSEFSSYDDRALM
AVGRAGTGWSFAFDGHPAPFHRQRFVPPTEAASAGTRAVVVWSGLRTWHGEPFFHLSVAR
DGTEQYAFTYADGEVRSSGEIPRALDPSRFFGDVEDGAGTERSLLEAVAGEFRVCLPRHA
LIDGRLHTFVTRSWTRPPGNGETYAVIRMHRGAPRPAGGERSGDDGPGSR
Download sequence
Identical sequences A0A0K8PH54
WP_059416520.1.19308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]