SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8QLD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8QLD1
Domain Number 1 Region: 41-146
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 6.44e-17
Family NIPSNAP 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8QLD1
Sequence length 153
Comment (tr|A0A0K8QLD1|A0A0K8QLD1_9GAMM) NIPSNAP family containing protein {ECO:0000313|EMBL:GAP65673.1} OX=1475481 OS=Mizugakiibacter sediminis. GN=MBSD_1293 OC=Rhodanobacteraceae; Mizugakiibacter.
Sequence
MTRSLKAAGYLFATVLVAAALAAATSARARTHAQLLTHGVVHQLRIYEIFDHNKQAFHDR
FRDHAMRIMARYDFPIVATWESRHDDRTEFVYLLEWPDKETMQRQWAKFMADKEWSDIKK
ATARQYGDLVGGIQDRTLLLTDYSPHKELLIPQ
Download sequence
Identical sequences A0A0K8QLD1
WP_062535645.1.26717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]