SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8R401 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8R401
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000000034
Family Fibrinogen C-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8R401
Sequence length 104
Comment (tr|A0A0K8R401|A0A0K8R401_IXORI) Putative ficolin/ixoderin {ECO:0000313|EMBL:JAA65204.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
YKLTIGDLNSSGDYDALSDQNGTEFSVRKSRPGTHDKGSCYGNTLSGGWWFKRCNYANLN
GRKLPMVFPEKPLGILWIIKGEMESPYYTYKKVEMKIRDADFGF
Download sequence
Identical sequences A0A0K8R401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]