SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8RGV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8RGV1
Domain Number 1 Region: 99-234
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 8.11e-23
Family ETX/MTX2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K8RGV1
Sequence length 282
Comment (tr|A0A0K8RGV1|A0A0K8RGV1_IXORI) Putative cytotoxin-like protein {ECO:0000313|EMBL:JAA69709.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MSGVFSMLPFLISQILFVKGQGHAHFPTGTQDKPIEGKNLQFNLQEVVLEFLYDVAKKEG
ANVWDMDVLGENPHRPKNGRPVVQAQMSDVTLEAARIASTRPMVAYTQLFHNGQPDRNET
ATIDKQIKHHNTYTFTVDRGIDTGFTGSWSAGIPDVVGAQTEISVKFSTLWGSTETKTKE
TTYSIKQQVNVPAESTVLVQMIITEEVMDVPWHATMELKGYFAGYFEKGSGKYWKYFPIG
DLRHPDVKKLAHDTILLRATGTFHGIKAKSSHTVTREKRHFR
Download sequence
Identical sequences A0A0K8RGV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]