SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8S9Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8S9Y9
Domain Number 1 Region: 33-148
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.24e-35
Family Cap-Gly domain 0.0000488
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.23e-33
Family Cap-Gly domain 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8S9Y9
Sequence length 326
Comment (tr|A0A0K8S9Y9|A0A0K8S9Y9_LYGHE) Uncharacterized protein {ECO:0000313|EMBL:JAG50101.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN= OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MAELPPPSKPSGLKPPSKIGRPCASNLPKPALPPQTPKMNNSVILTEDTDSFIVGDRVWV
GGTKPGRIAYIGETQFAPGDWAGIVLDEPIGKNDGAVGNTRYFQCEAKKGIFSKLTRLTR
VPFALPEPSAQTPVPSTPLASPPSSVRGSIASRSPPPSSVASTPASAPNGELKIGERVIV
MSQQGSKAGVLRFKGTTGFAPGEWCGVELDDPLGKNDGTVDGVRYFTCEPKFGLFAPAHK
VSRSPAKNRRPSCQVHHNATSIRRASSKESLTSSIASVASSVRTNNTSYTARKALIRPLT
SPTTPKPSAQVTIIKYYYPHWEQDFF
Download sequence
Identical sequences A0A0K8S9Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]