SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8THI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8THI5
Domain Number 1 Region: 62-158
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000484
Family Insect pheromone/odorant-binding proteins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8THI5
Sequence length 195
Comment (tr|A0A0K8THI5|A0A0K8THI5_LYGHE) Uncharacterized protein {ECO:0000313|EMBL:JAG64881.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN= OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MTSCFIILITVAAATLSVSAQELREECKDVDQLKIQIETFHGCCDLVSKIRKIERPKEEE
EAWNICKEEWKKKDFTAGNRTPASEGHDCLMECVLKRQGAMGQDFKFDKEKMHELFLNGF
PEELREAGKQAMEKCMNKNFSKKYCASGVTGVFMCFSEELVMNCPANIWTSDEKCTAAKE
YMTKCPSYQTMVDHE
Download sequence
Identical sequences A0A0K8THI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]