SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8TKK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8TKK0
Domain Number 1 Region: 94-345
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.07e-81
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000627
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily SNARE-like 1.69e-21
Family Clathrin coat assembly domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K8TKK0
Sequence length 346
Comment (tr|A0A0K8TKK0|A0A0K8TKK0_TABBR) Putative adaptor complex medium subunit family {ECO:0000313|EMBL:JAI14834.1} OX=304241 OS=Tabanus bromius (Band-eyed brown horse fly). GN= OC=Tabanoidea; Tabanidae; Tabanus.
Sequence
QEVPPLFVIEFLHRIVDTFEDYFSDCTESTIKENYVVVYELLDEMLDNGFPLATESNILK
ELIKPPNILRTIANTVTGKSNLSGVLPSGQLSAIPWRRSGVKYTNNEAYFDVVEEVDAII
DKSGSTVFAEIQGYIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRFKRWESERILSFI
PPDGNFRLMSYHIGSQSVVAIPIYVRHSLSFKSGEQGRLDITVGPRTTLGRTVESVKLEI
CMPKCVLNCVLVPNQGKYTFDPVSKNLHWDVGRIDISKLPNIRGTVSVTAGSSNLETNPS
INVQFSISQLAVSGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQIRM
Download sequence
Identical sequences A0A0K8TKK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]