SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8UGA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8UGA1
Domain Number 1 Region: 75-258
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-48
Family CRAL/TRIO domain 0.0000339
Further Details:      
 
Domain Number 2 Region: 4-69
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 3.14e-17
Family CRAL/TRIO N-terminal domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8UGA1
Sequence length 262
Comment (tr|A0A0K8UGA1|A0A0K8UGA1_BACLA) SEC14-like protein 2 {ECO:0000313|EMBL:JAI25330.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c2_g1_i2 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MSDMPNISDAQETALKQFRKSVSDVINETHDDYFLLRWLRARKWDPEAAEEMLRASLKTR
AMWNVDNLEKWDAPRALREYLPYGLIGYDNEGSPVIVCPFYNFDIWGMLHCVTRFDFQRY
LVLLLERFMQAGYEQSKTHGPQARQLVVFFDMANFNLKQYAWRPAAECVLSTVKQYESNY
PELLKMCYIVNAPKLFSVAFNFVKRFLDEYTMSKIKIYKNGSDKWKEPLFSHVDPNIFPK
CFGGKYVDENGDPECKSKVSRI
Download sequence
Identical sequences A0A0K8UGA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]