SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8UM13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8UM13
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000204
Family Tachycitin 0.041
Further Details:      
 
Domain Number 2 Region: 156-205
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000915
Family Tachycitin 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8UM13
Sequence length 206
Comment (tr|A0A0K8UM13|A0A0K8UM13_BACLA) Uncharacterized protein {ECO:0000313|EMBL:JAI27410.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c1_g1_i2 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
LPPGQTCQGEGYMADPLNCRKFYRCVREGDSYTKYEFTCAKGTGWSEDKQTCDYAPNIER
CEGQTEEPETSTITTETTIESSTTTVTAEKPTTEESSTTTPVTEKPTTAPTQPTIVQTST
AWTTTEIPSTTTSTSTWSTEAGDDSTTTSQPTSSTPIPNLPPGQTCQGEGYMADPLNCRK
FYRCVREGDSYTKYEFTCAKGTGWSE
Download sequence
Identical sequences A0A0K8UM13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]