SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8UXF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8UXF5
Domain Number 1 Region: 116-160
Classification Level Classification E-value
Superfamily FnI-like domain 0.000045
Family Fibronectin type I module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8UXF5
Sequence length 1546
Comment (tr|A0A0K8UXF5|A0A0K8UXF5_BACLA) Collagen alpha-2(I) chain {ECO:0000313|EMBL:JAI31050.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c0_g3_i1 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MKYKHLRLLCLAFVLCILLEFAAAGKPGTKQKTKVGKIKKHRKAFMERPQAEEPRAGADL
PGAEEFEAYDYNNYEDVDVDADANVGGPDGFDTHQEAHDPVVLAAVDAPSNVVGAFSCLY
EGNWYREGDEFTSERDGCTHPCSCIEGKVICREPTHCIPPTPISTTTTTTTTTTERNVDL
PAEENPYAGVATGQRGLPGYPGAQGRQGESGNPGSPGVPGVPGNPGAPGPIPDMSYYHQQ
LAAEYANSEKGPSSPPFVPEFQYLQSSVGPVGPRGPPGNLGPSGPQGFQGMRGEPGEPGS
QGPPGLMGPRGLPGAPGKDGVPGEDGEPGLQGAAGTPGPRGLPGMPGIPGLKGHHGLPGI
DGSKGDQGAPGEKGSTGPMGAVGPTGSQGPAGPRGERGREGPPGPPGTRGLDGNPGTIGQ
PGAIGKPGPPGFPGSPGAKGDWGHPGPKGDQGLQGPRGEAGRPGAAGEPGMPGPPGKDGL
HGDKGSMGAPGIAGPQGFPGPRGPDGLPGSPGEPGIKGTPGQPGERGYKGDQGVKGESGQ
PGPRGLPGTVGPEGKRGKRGMRGPTGPSGPTGERGSQGLPGLPGPDGPIGPKGTPGDRGI
QGPPGIKGSTGDVGQPGVPGVQGLRGLPGRIGPPGKTGPAGERGIPGADGKPGEQGPQGL
QGMPGPMGIPGDKGFTGEPGKNGEPGPPGPQGPHGDSGKDGLPGAQGPRGPPGQDGERGE
PGSAGPRGFQGLPGVAGNPGAPGKDGSAGPPGPQGLVGPAGLRGERGYPGERGPVGQPGT
PGERGEPGTPGNDGPPGSPGKPGAKGHMGAPGMLGLPGPRGLSGPPGGKGERGSPGPFGP
EGPPGRPGDRGPQGIVGPPGAPGESGERGEPGNPGPPGEQGAAGGPGERGPAGLQGPPGF
PGAPGLAGLPGAKGDRGLMGIKGEQGSIGPHGPPGEQGPIGPVGLSGAKGARGEPGLRGE
PGLSGLPGRPGDQGPPGLPGSQGLPGVAGFPGAKGNPGETGRPGNPGSPGLQGPPGVEGQ
KGDTGNDGPPGPTGNPGPPGNVGERGMPGISGPPGPAGLRGLRGVAGEAGPQGNPGKDGA
PGVQGLQGPQGLPGPMGESGPEGLPGKPGPPGIAGRTGDKGPQGQQGNPGPPGNPGLPGP
PGAMGPLGLQGEPGLKGDMGLPGVEGPQGLRGKPGPPGVEGPKGELGEPGPKGIKGHRGL
IGLQGMPGQPGLKGDVGSPGIPGQPGKVGEMGMRGPQGRDGSPGPIGPPGQPGPRGYNGG
DGKPGPIGPAGPPGPPGPPGESVGYDVAALTALLNQGQTKGEDFQGDQPSILPDGLSDEE
KQAMVIKAFEHLKASFERLRRPNGQQTAPAKTCRDLFAAYPDYKSGEYWIDPNEADPRDA
ILVYCERETRGSCVLPKPQETPVLSYAGAERETWLSEMPGGMKIAYKTDSHQLGFLQLLS
AKATQKITFNCRNTIGYLDEDETKNRNGLKLLSWNDAELTPKGPLRLRYEAESDECRHRS
NAWAKTIITYKTEKPQRLPIVDIKIRDIGEANQQFRIELGPVCFYN
Download sequence
Identical sequences A0A0K8UXF5
XP_018785198.1.52592 XP_018785199.1.52592 XP_018785200.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]