SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8UZF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8UZF9
Domain Number 1 Region: 104-224
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.02e-33
Family cAMP-binding domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 228-351
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-31
Family cAMP-binding domain 0.0000702
Further Details:      
 
Domain Number 3 Region: 6-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000523
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8UZF9
Sequence length 375
Comment (tr|A0A0K8UZF9|A0A0K8UZF9_BACLA) cAMP-dependent protein kinase type II regulatory subunit {ECO:0000313|EMBL:JAI31986.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c2_g4_i5 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MSTDSKQRIQVPEALREVLLEFSIAYLLEQPGDVVDYAVQYFNKLQSNRQAAANFYRPDS
PESSIISQEEEPVRRFTTRRKSVFAEAYDPENDADDDEAERKVYPKSDEQRARLTDSVKN
VLLFRSLDDEQMNQVLDAMFEKRVQPEEFIIRQGDDGDNFYVIESGVYKVICNGDHIFTY
DNTGIFGELALLYNVPRAASIQAVTEGLLWAMDRQTFRRILLKSAFKKRKMYETLLDSVP
MLKALKSYERMNLADALVSKHFSSNERIIKQGDVADGMYFIEDGNVSVKMDQDGKEIEIS
RLGKGQYFGELALVTHRPRAASVYADGDVKVAFLEVRAFERLLGPCMEIMKRNIDDYETQ
LIKIFGTKNNISDTR
Download sequence
Identical sequences A0A0K8UZF9
XP_018795862.1.52592 XP_018795863.1.52592 XP_018795864.1.52592 XP_018795865.1.52592 XP_018795866.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]