SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8VD26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8VD26
Domain Number 1 Region: 109-229
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-33
Family cAMP-binding domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 233-356
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-31
Family cAMP-binding domain 0.0000702
Further Details:      
 
Domain Number 3 Region: 11-54
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000523
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8VD26
Sequence length 380
Comment (tr|A0A0K8VD26|A0A0K8VD26_BACLA) cAMP-dependent protein kinase type II regulatory subunit {ECO:0000313|EMBL:JAI36732.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c2_g4_i4 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MIAENMSTDSKQRIQVPEALREVLLEFSIAYLLEQPGDVVDYAVQYFNKLQSNRQAAANF
YRPDSPESSIISQEEEPVRRFTTRRKSVFAEAYDPENDADDDEAERKVYPKSDEQRARLT
DSVKNVLLFRSLDDEQMNQVLDAMFEKRVQPEEFIIRQGDDGDNFYVIESGVYKVICNGD
HIFTYDNTGIFGELALLYNVPRAASIQAVTEGLLWAMDRQTFRRILLKSAFKKRKMYETL
LDSVPMLKALKSYERMNLADALVSKHFSSNERIIKQGDVADGMYFIEDGNVSVKMDQDGK
EIEISRLGKGQYFGELALVTHRPRAASVYADGDVKVAFLEVRAFERLLGPCMEIMKRNID
DYETQLIKIFGTKNNISDTR
Download sequence
Identical sequences A0A0K8VD26
XP_018795859.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]