SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9H5A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9H5A5
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.22e-27
Family SMI1/KNR4-like 0.0087
Further Details:      
 
Domain Number 2 Region: 178-256
Classification Level Classification E-value
Superfamily ARM repeat 0.0000241
Family Armadillo repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K9H5A5
Sequence length 262
Comment (tr|A0A0K9H5A5|A0A0K9H5A5_9BACI) Cell wall assembly protein {ECO:0000313|EMBL:KMY54129.1} KW=Complete proteome; Reference proteome OX=1679168 OS=Bacillus sp. FJAT-27231. GN=AC623_09440 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKIWRDEQEDMYKLPDLKESDIKQTEKLFSVTFPKEYIELLQVQNGGLIMYNAFPTTFRT
DWNDDSIYLDHIMGIGKEHGILENDYYIKEWGLPEGLLLISGDGHSWIAFDYRKTPENPP
IVYIDNENEQIITLASSFQEFLDKLYIEEAPSLHEYEKVMVSKEVMENYIHANNIEGMVE
SIDIMSTSLSIDIQWFIQKLLELSRHENKEVRVSAAMAVLYLLQTSELEKERETVEELLE
IFRQDSDGDVNYYAELIKKGLE
Download sequence
Identical sequences A0A0K9H5A5
WP_049662201.1.42397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]