SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9MM97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9MM97
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000301
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K9MM97
Sequence length 126
Comment (tr|A0A0K9MM97|A0A0K9MM97_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KMZ44925.1} KW=Complete proteome OX=1679167 OS=Bacillus sp. FJAT-27238. GN=AC624_18100 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEANLKSFDLPEDYVKFLHEFDSAVLFRTLRQGGGCSILSPQLVIQYWKGYGIDHPYYPI
AWSSHSLGCICVDQDRLDNGNGYLTWIESMDPDNPIDIDLTFTEWFDKLIEHEGKEFWIP
FNEEEE
Download sequence
Identical sequences A0A0K9MM97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]