SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9MPH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K9MPH1
Domain Number - Region: 41-110
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0785
Family Staphylocoagulase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K9MPH1
Sequence length 195
Comment (tr|A0A0K9MPH1|A0A0K9MPH1_HELPX) Flagellar motor protein {ECO:0000313|EMBL:KMZ46374.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=AC783_04375 OC=Helicobacteraceae; Helicobacter.
Sequence
MNLRLAGASVLTACVFSGCFFLKMFDKKLSSNDWHIQKVEMNHQVYDIETMLADSAFREH
EEEQDSSLNTALPEDKAALEAKEQEQKEKRKHWYELFKKRPKPKSSMGEFVFDQKENRIY
GKGYCNRYFASYVWQGDRHIGIEDSGISRKVCKDEHLMAFELEFMENFKGNFTVTKGKDT
LILDNQKMKIYLKTP
Download sequence
Identical sequences A0A0K9MPH1 I9PNQ1 T5CZ65 U4R834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]