SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9PK90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9PK90
Domain Number 1 Region: 3-260
Classification Level Classification E-value
Superfamily LigB-like 5.1e-91
Family LigB-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9PK90
Sequence length 263
Comment (tr|A0A0K9PK90|A0A0K9PK90_ZOSMR) 4,5 dioxygenase extradiol {ECO:0000313|EMBL:KMZ69379.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_215G00130 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MDTFFLSHGSPTLSIDESIPARKFFQSWRNTMMPNVTPTAILIVSGHWDTKEPTVNVISG
RNETIYDFYGFPKSMYQIKYPAPGAPELALKVKSLLKDAGFGHVKEDKKRGLDHGAWVPL
MLMYPDADVPVCQLSVQSNKDGTHHYNMGKALRPLREQGVLVLGSGSSTHNLRQIEPEGA
PVANWAFQFSSWLKDSLLNGRYEDVNTYENKAPYAKKAHPWPDHFYPLHVAMGAAGENSK
ARLIHDSWTHGTLSYSSYGFKSI
Download sequence
Identical sequences A0A0K9PK90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]