SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9PW54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9PW54
Domain Number 1 Region: 54-181
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 3.4e-18
Family Chlorophyll a-b binding protein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9PW54
Sequence length 184
Comment (tr|A0A0K9PW54|A0A0K9PW54_ZOSMR) Early light-induced protein {ECO:0000313|EMBL:KMZ73154.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_152G00070 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MAMSTIQFCMVNPMSSVGSGTNRPTFAKVGRIRCQTSEDRTVNKNGEMPQPSSSPSPSTP
PPPPPAPKPKVSTKFTDVLAFGGPAPERINGRLAMVGFVSAIAVELANGNDIITQVSNGG
VSSFLLVTGILSAASLVPLFKGVSVDSISGQVMSSKAEMWNGRFAMLGLVALVFTEYLKG
GPLV
Download sequence
Identical sequences A0A0K9PW54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]