SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9PZ26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9PZ26
Domain Number 1 Region: 186-248
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 3.37e-18
Family Transcriptional coactivator PC4 C-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 28-82
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000497
Family DEK C-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K9PZ26
Sequence length 250
Comment (tr|A0A0K9PZ26|A0A0K9PZ26_ZOSMR) Uncharacterized protein {ECO:0000313|EMBL:KMZ73475.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_148G00230 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MNDSEFRATGSGGMKAAADDEEAMDKETQIRVRDAVLTMLQNADLDTTTEFKIRNTVSDF
LGINLHLPNRKAFVKKIIEIFIVSTAEVSGIQETENLMTSERKTDVEETENLMTSERKTD
VEETENLMMTSERKTDVEETENLMTSERKSDVEEETENPISGDQSSKMKETKKKGSMGSD
NDESVICHLSKNRRVSIQEFKGMKLVSIREFYEKNGIQLPSHKGISLTCEQWAILRKSTS
KIEAAVAKLK
Download sequence
Identical sequences A0A0K9PZ26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]