SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9Q050 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9Q050
Domain Number 1 Region: 4-78
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 3.92e-30
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K9Q050
Sequence length 103
Comment (tr|A0A0K9Q050|A0A0K9Q050_ZOSMR) Signal recognition particle 9 kDa protein {ECO:0000256|PIRNR:PIRNR017029} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_13G00860 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MVYITSWDEFAERSVQLFRANPESSRYVMKYRHCDGKLVLKVTDNRECLKFKTDQAQDAK
KMEKLNNIFFALMARGPEADLSEVSVKDQVEQQPSRKGRGRRQ
Download sequence
Identical sequences A0A0K9Q050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]