SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9RDU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9RDU6
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.000000000000101
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0015
Further Details:      
 
Domain Number 2 Region: 84-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000661
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9RDU6
Sequence length 175
Comment (tr|A0A0K9RDU6|A0A0K9RDU6_SPIOL) Uncharacterized protein {ECO:0000313|EMBL:KNA17149.1} KW=Complete proteome; Reference proteome OX=3562 OS=Spinacia oleracea (Spinach). GN=SOVF_082690 OC=Anserineae; Spinacia.
Sequence
MFIKVQLPWNVIIPCEHMDVKGLMLQKSIILRLMEDFTSKKATKELGYLLAVTTLDNIGE
GRVRQQTGDVLFPVTFSCLTFKIFRGEVLEGTVHKVLRHGVFLRCGPIETIFLSAQKMPG
YQHVPGESPMFISEKQSKIEKDVVVRFCVIGTKWVETEREFQAVVGLEGDYLGPV
Download sequence
Identical sequences A0A0K9RDU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]