SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9XM68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9XM68
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000432
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K9XM68
Sequence length 181
Comment (tr|A0A0K9XM68|A0A0K9XM68_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KNB54181.1} KW=Complete proteome; Reference proteome OX=1678637 OS=Streptomyces caatingaensis. GN=AC230_02055 OC=Streptomyces.
Sequence
MAVRQVTGAWQRIETWLREHAPVSFASLQAGASREEIDRAEGELGVRVPAELKALWGLHR
GVHSSVGAAFLQDNAKLMTIAEAIELHRHWREVYDDHLWDRRWIPVCTLGEHSWSSGLYL
DAGTGEVWSWDEFANRQVEFESLTSYLEEMADALEVPSLAGPDKPSLVDGALAWGPGSEP
A
Download sequence
Identical sequences A0A0K9XM68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]