SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9XZ40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9XZ40
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.57e-24
Family Thiamin pyrophosphokinase, catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 138-201
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000000183
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9XZ40
Sequence length 209
Comment (tr|A0A0K9XZ40|A0A0K9XZ40_9FLAO) Thiamine pyrophosphokinase {ECO:0000313|EMBL:KNB61205.1} KW=Complete proteome; Reference proteome OX=1681828 OS=Chryseobacterium sp. Hurlbut01. GN=AC804_11570 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MRDKVLLFINGDPPKSLPNVKEYTFIACTDGAFHYLKQLGFPLEKLDFISGDFDSHSGAD
ENVYEDKFIYTPDQNKTDFHKALDIILEKGYQNIDVFGGSGGEQDHFLGNLTVAYSFKEN
LNLKFYDEFSEYFFVPKSVVLKNVKDKLISLYPFPTAENITTKGLNWSLNNENLSVTARI
GTRNFAIEDEVSIQYEKGDLLVFIGKKYL
Download sequence
Identical sequences A0A0K9XZ40
WP_050379505.1.80562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]