SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0BN60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0BN60
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 2.88e-28
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0BN60
Sequence length 109
Comment (tr|A0A0L0BN60|A0A0L0BN60_LUCCU) Uncharacterized protein {ECO:0000313|EMBL:KNC21442.1} KW=Complete proteome; Reference proteome OX=7375 OS=Lucilia cuprina (Green bottle fly) (Australian sheep blowfly). GN=FF38_12585 OC=Oestroidea; Calliphoridae; Luciliinae; Lucilia.
Sequence
MVLLDNSSFIIRLQKLATSAKIDSSFTVTFKRYNGHDKPKPREGKPALPEPEEYMCLVRA
QSKSKKLSTVVKHEDVPKMMTMYAQFMKSNMDGLKRVKKVKSKAKAAKG
Download sequence
Identical sequences A0A0L0BN60
KNC21442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]