SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0DA67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DA67
Domain Number 1 Region: 234-325
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000379
Family Second domain of FERM 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DA67
Sequence length 572
Comment (tr|A0A0L0DA67|A0A0L0DA67_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC49237.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_05227 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MAAAATSATAPAMNTNEEEDNSGEMMAVTLTLGPRGSDTHRAMFPASATANEVLATLDAV
AELDIDPQRVALLIPGAAEREAETAELSAEEMSMQKPRLLGSRSAPRWLAGEARLGSARL
GHEPRLSLRRRTRRVRILVTSFSKVLRYDVCAPVGELLAAFASRIALANPEEFGLTMVGL
GPHKWLDLTLPLHCQVWSPEVSESDDALIQLKFRRRLYASHLDLSACVLPVVSLEIADDV
RAGRYLVDTAKAVELTALHLAVYAPRELTALPSPLDEYLPAQVVEAVRSDELHARILARH
AELRQEEGRALAEAYVQAAAALPLFGATRIECGENGVTLSIGREHGLVVLDGMYGTSPPP
LATLDIAEWKAGERGRPTQSAIIDIVALEAIVGWRHTSRTVTLVLGSEPEREVTFGTARA
DEVVHQLERLTELLSAETGQRAWEQAEWTDGMHVSPMFASGEHEFQPELFEVDLLRPRGG
GAVIDGSWAPGAPTALELTLVLHALIGGAAALSAAGDGESVHRRMWLAWAAAAGAVRLLA
AVSPHEFGLFLALPPIRLFCLDGCSHLLEQSQ
Download sequence
Identical sequences A0A0L0DA67
AMSG_05227T0 XP_013757954.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]