SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0DQ03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DQ03
Domain Number 1 Region: 150-425
Classification Level Classification E-value
Superfamily PP2C-like 5.62e-36
Family PP2C-like 0.0019
Further Details:      
 
Domain Number 2 Region: 20-59
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DQ03
Sequence length 433
Comment (tr|A0A0L0DQ03|A0A0L0DQ03_THETB) Protein phosphatase 1L {ECO:0000313|EMBL:KNC54382.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_10101 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MQSVGRRGAVPGAGPRPSGALEYLEHHALRAVFEAMTIAVIVNRPDDPLSYLAAHLQALP
SPMNHAERTRLATSPEYYMAAPEPASEPVSAPRPGREPPAAPMTEDEPEAVVEAGGGETK
AQAGTLADDAAEATVLAVDVWAGKRAGGVRYMEDDALALASVSPRSYPFDGLLGVFDGHS
GDKKAGRAAAGLAKVLAAGEFVRAEQAALRSRDVELDVDKVFVNMFDAMQRMMVKRLKRN
VEYAGTTATVAVIRDDGDLLAANVGDSSGLLCTYWLDAGEEQLAAVATPLTTDHVATDEV
ERERVVAAGGFITDDAKFGRRVNGLQVTRSLGDVGSPGTVATPSTTRIPLGKGNVLGVDV
PPNAVSLVQYVVLASDGVWGGISVQALLDEIIQPEMRAAAAGEAILNAAEERADPNALDN
LSVAVYCRVTKPV
Download sequence
Identical sequences A0A0L0DQ03
AMSG_10101T0 XP_013753682.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]