SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0DR32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DR32
Domain Number 1 Region: 108-178
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.57e-19
Family AN1-like Zinc finger 0.00052
Further Details:      
 
Weak hits

Sequence:  A0A0L0DR32
Domain Number - Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000385
Family A20-like zinc finger 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DR32
Sequence length 183
Comment (tr|A0A0L0DR32|A0A0L0DR32_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC54769.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_01621 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MSSSNNDASTPQACIDGCGFFASAATDRCSACHRKHMSESMQDLASGGQDAPSSPAAWAA
AAADAAFAASNVLPAEGGDDVASMPAPMDVAPAETEAVKAPAMAAAAADETPKKKKKKKA
RCAHAECRTKIGTRGFECACGASFCGSHRYAWAHDCTHDFAAEARDRLRAANPVVSPEKV
ARI
Download sequence
Identical sequences A0A0L0DR32
XP_013761669.1.50528 AMSG_01621T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]