SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0F8X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L0F8X6
Domain Number - Region: 86-109
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0405
Family Proteinase A inhibitor IA3 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0F8X6
Sequence length 186
Comment (tr|A0A0L0F8X6|A0A0L0F8X6_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC73011.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_14428 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MQRLATVRTLTASTMPAFRVHSRSVSNVMNKGSLNTTHLITKSISTTLCRMRLPCKHTLK
THMSHAGSMQMSYIRAFCSSIVRRQDTGKQPEITQSTDAQLQGDADILDPSITSAHGTES
NTSSQLEESEHDPLYMQVEIDSEDEESDGEGRGRMVDANEVRATDTATRLELEDIVEMLN
LSHCRC
Download sequence
Identical sequences A0A0L0F8X6
XP_014146913.1.97753 SARC_14428T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]