SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0HP29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L0HP29
Domain Number - Region: 8-56
Classification Level Classification E-value
Superfamily Annexin 0.0237
Family Annexin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0HP29
Sequence length 132
Comment (tr|A0A0L0HP29|A0A0L0HP29_SPIPN) Uncharacterized protein {ECO:0000313|EMBL:KND02852.1} KW=Complete proteome; Reference proteome OX=645134 OS=Spizellomyces punctatus DAOM BR117. GN=SPPG_01931 OC=Spizellomycetales; Spizellomycetaceae; Spizellomyces.
Sequence
MEKMMRRASEEELNEMKRFYQLTVDNEMHQAVVTTNRRRKEAIERKMVKKDVRTIIGEDG
SNMYVASLVEEKLNALVDDVKQGLMEAGYTEDQVMEIITIYHKQRKVLRLKVSRVPSVKE
GGEMESQAKVIS
Download sequence
Identical sequences A0A0L0HP29
XP_016610891.1.7107 SPPG_01931T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]