SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0K7C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0K7C6
Domain Number 1 Region: 31-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000085
Family SMI1/KNR4-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0K7C6
Sequence length 577
Comment (tr|A0A0L0K7C6|A0A0L0K7C6_9ACTN) Cell wall assembly protein {ECO:0000313|EMBL:KND33540.1} KW=Complete proteome; Reference proteome OX=42234 OS=Streptomyces acidiscabies. GN=IQ63_19260 OC=Streptomyces.
Sequence
MRNSDWRPFLTRWSEEWADASDEPSPERDARWLGFAGASEERISALEERLGCRLPPSYRG
FLAVSDGWLHAGSFVWRLAGVDEVGPYSDDAGLGEMYRGELDERSTPEEVLEAGMWGRAL
QLETESDLTNVLLDPGDVDSDGEWACYDYASWRGEGPVRYGSFAEFMEAMYRQFHSMSAH
SLGPGFVNSTTLAQDAAVSGARVDALRGRYEEARAALDEAYEYGRPLATELRDQLKYLSG
ETYTVSFGTLATDPLYQPEVRPALAAERLRMGHRRTDDDLRYPAPGPFGEAVEEARESAR
WGDTDAAWRILRAALPEWRPVGPDLIAPLGLLADPVLGPVCTPERCRELLATPRAGETGE
VPPPTPDLDPPGLSWLADPDSGDRLSSYRLILVEGVDPTDLPARIGGAALGEPMTYWEAH
LDESRFAVGRAGPDWSFAFEAAPHQRFYEPRFVSPAPAASPGTRAIAIWRESDDSPLFHL
SVAENGEERYAFTVRGDEVHRTGPIPPSLNPEPLDERRVLESLGSEFGVHLPRHALFHGR
LHTLVPRPWSRPAGPGEGYVTLDTHPPRLPRGRFSQE
Download sequence
Identical sequences A0A0L0K7C6
WP_050371754.1.1573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]