SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0KN55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0KN55
Domain Number 1 Region: 145-298
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.66e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0KN55
Sequence length 326
Comment (tr|A0A0L0KN55|A0A0L0KN55_9ACTN) SMI1 / KNR4 family protein {ECO:0000313|EMBL:GAQ57644.1} KW=Complete proteome; Reference proteome OX=42234 OS=Streptomyces acidiscabies. GN=a10_07515 OC=Streptomyces.
Sequence
MTTGRLGQTAPPNAAYAGQVVHFPDPVRAGRHPRGVRVDERGYPDFSPYARAVAEIADPP
EGFGVDELRLTDYVSANAAQSAAGHELWDTVSQVATPHGWTWHHVAGTRRLELIPVDVKA
LLRHHGGISTARVDHAKRGTRPLQEIRPAHFRLPKSGVAVTEAQVQGVEEDLGYRLPGAY
RSFLKAAGGCAPVGAALDAELGLLVDQPFFTVRDEAAVNDLVYVNKCLRDHLTKDYLGVG
FVQGGLVAVKVKGERLGSVWFCAYDDVRDADPTWPPAERVERLLVPCGDDFDAFLSRLAG
DPPELETVANLMVDGGFARVVPVAGE
Download sequence
Identical sequences A0A0L0KN55
WP_010354878.1.1573 WP_010354878.1.36807 WP_010354878.1.57582 WP_010354878.1.64676 WP_010354878.1.69083 WP_010354878.1.73281 WP_010354878.1.79048 WP_010354878.1.9990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]