SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0L332 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0L332
Domain Number 1 Region: 161-277
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-16
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0L332
Sequence length 336
Comment (tr|A0A0L0L332|A0A0L0L332_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KND44436.1} KW=Complete proteome OX=146820 OS=Streptomyces stelliscabiei. GN=IQ64_12710 OC=Streptomyces.
Sequence
MTTGRLGQQAAPPNAAYAGQVVQFPDPVRAARHPRGVRVDAHGYPDFSPYARAAAEIADP
PEGFGVDELRLTDYVSANAALAATGHELWDTIPPVATPHGWTWHHAPGGRRLELVPVEVK
ALLRHHGGIATARVDQHKRGTRPLQETRPAHFGLPKSSAVAVTEAQVQGVEEDLGYRLPG
AYRSFLKAAGGCAPVGAALDAELGLLVDQPFFTVRDEAAVNDLVYVNKCLRDHLTKDYLA
VAFAQGGILAVKVKGDRIGSVWFCAYDDARDVDPSWPPAERVERLLLPAGADFDAFLSRL
AGNPPELETVANLMVDGGFAHAVPVAAGAAVSSVGE
Download sequence
Identical sequences A0A0L0L332 A0A286F155 M3FDA7
WP_005485797.1.101488 WP_005485797.1.16795 WP_005485797.1.24432 WP_005485797.1.94594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]