SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0L5N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0L5N0
Domain Number 1 Region: 66-215
Classification Level Classification E-value
Superfamily Sortase 0.000000000000051
Family Sortase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0L5N0
Sequence length 219
Comment (tr|A0A0L0L5N0|A0A0L0L5N0_9ACTN) Peptidase C60 {ECO:0000313|EMBL:KND45215.1} KW=Complete proteome OX=146820 OS=Streptomyces stelliscabiei. GN=IQ64_08225 OC=Streptomyces.
Sequence
MRRLSDSVIAGVTVVALFCGAWLVRSGTASHAPPQPSAAQAHLRSGTPSASPEPGGASTA
PAAVPLPPSPPDRIRIPSLRVDAPLMGLGLTPAGSLDVPPAAKENLAGWYEAGTSPGARG
TSIVAGHVDNAEGPAVFFRLGALKRGAIVEVDRRYGGTAVFTVDAVEVYDARDFPDEKVY
GAATRPELRVITCGGGYSRATGYQGNVVVFAHLTGSRPG
Download sequence
Identical sequences A0A0L0L5N0
WP_046919510.1.24432 WP_046919510.1.94594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]