SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0N2Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0N2Y0
Domain Number 1 Region: 29-200
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.84e-29
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00054
Further Details:      
 
Domain Number 2 Region: 388-498
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000126
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0N2Y0
Sequence length 590
Comment (tr|A0A0L0N2Y0|A0A0L0N2Y0_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:KND88165.1} KW=Complete proteome; Reference proteome OX=1163406 OS=Tolypocladium ophioglossoides CBS 100239. GN=TOPH_07244 OC=Tolypocladium.
Sequence
MANYPSFPPRLTSTASSCSSLNETNTRNRRLRLLVAATGPRDTSWAQALVVRLSKNPEIE
TRAIVDDVVPRLTQTIIVMENRSLAPRQGDRADDIEFYRQQAYELVEWADLMVCVPLDAD
GIAKMLAGIADTFLGEVLRGWNIQKNVVLVPGMSTYMWANPTTKRHLSKLYRKWNWIRVM
TPILWHYEGSPNPKRVPNWNGFNEVLGIIKNQADLLGLGRDVEIATSTAVVSDSDVRIQS
KLPPEIWTIVLDYAGDWELAKALGMYTNLPMPQPWCLEPKDPSDALKVYEHELEWTVLTG
NSAAICKKLSQSPPNFQDIPALVVKLVIRFALIGVLEYMEVNRPDLFKAFDGTTLPTNAS
AYYPRTDVLDYWKQSRWFRDKHIYDAEAVDGASKNGHVRILDWWWRRSGLSLRYTETALE
QASGKGHLLVLEWWRDAAAQDESIVLRPGRSLLWATQHGQAHVLQWWDASGIPVAHGDGV
AKVASRWGRVDVLETWRRLKGDNKLVFDAEVLISSTIHQHVEVLEWWRKFAHGELEGMDG
RKQLVEFRTCNIEEALEDSIGDQSKARKWWAQYGLDLRMRDEEWLQTRYL
Download sequence
Identical sequences A0A0L0N2Y0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]