SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0QL62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0QL62
Domain Number 1 Region: 30-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.62e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0QL62
Sequence length 157
Comment (tr|A0A0L0QL62|A0A0L0QL62_VIRPA) Uncharacterized protein {ECO:0000313|EMBL:KNE19365.1} KW=Complete proteome; Reference proteome OX=1473 OS=Virgibacillus pantothenticus. GN=AFK71_12715 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Virgibacillus.
Sequence
MYDFEFLNKYVSELNNPQNQDKKHIIYRLEDDVIEAEKRLGEKFPNELREFYLKVGYGFI
CNFDKTRRNRLMDPHSVADFILGEDDFIDSTIRELYPDNMLVFFEVGEGTYLTLDLEQEQ
EGGICPVYYFEEKIATSLEEFLKRMDEETDYYIHLNE
Download sequence
Identical sequences A0A0L0QL62
WP_050351893.1.20200 WP_050351893.1.83966 WP_050351893.1.90692 WP_050351893.1.92105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]