SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0QRC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0QRC2
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000471
Family SMI1/KNR4-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0QRC2
Sequence length 76
Comment (tr|A0A0L0QRC2|A0A0L0QRC2_VIRPA) Uncharacterized protein {ECO:0000313|EMBL:KNE21144.1} KW=Complete proteome; Reference proteome OX=1473 OS=Virgibacillus pantothenticus. GN=AFK71_05480 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Virgibacillus.
Sequence
MNINPFKGATEELISNFEKMIGFSLPTDYKQFLLRYNGGTTKKRYSTFFVKELNQIIQLD
VLYGIGVDDEAFDLET
Download sequence
Identical sequences A0A0L0QRC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]