SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0RWM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L0RWM5
Domain Number - Region: 5-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0RWM5
Sequence length 521
Comment (tr|A0A0L0RWM5|A0A0L0RWM5_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE54499.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_00471 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MEDVNQAKQYLQQHSDRTGINLYDHLTELLAQVLEKRPRNPADVFENISSQVKRDRFNLE
SIQSPLGYKKKPEPNPSLGQVNKLMTVFQSVKRSEDGNDDAAGQVPDILELSGLFEWAGV
SFGKEETFLLALSIHQLVQETGLQSARFWGKLSARQGAYYVVEAEGAPPVEDDPEKVAAD
KAAVEPAKPPPMDVPEFEGFPDIKRPVDMPLPKEEGTGVNKYTYFVCTSIGEAWTRLPDL
LPEHVTAARAIRKYLTGNLSTPIVSYPLYPGTEAHYLRSQIARITAATVVCPLGYYTFDP
ESADEEHPETNTAIIVNTEYEVLPNDALLSLENWVHQIPHVLPQGRTTWVNPVKPRGEGE
DEDADREDGEGEDDDDASGDATGGASEREVEPETGPALLTSITEDAEFAGHPAWSVRACS
RLQPSKFSPVHLRSNRWPGAHAVYYNGKFACVYVGDGLKDLGGEPTPMPALPPLQVEFKD
EALVELVDPSVKDEKAFEEMLKEKEDDAQPDEEDGEEEPAD
Download sequence
Identical sequences A0A0L0RWM5
AMAG_00471T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]