SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0RXV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0RXV5
Domain Number 1 Region: 10-168
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.8e-22
Family C-terminal, gelsolin-like domain of Sec23/24 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0RXV5
Sequence length 172
Comment (tr|A0A0L0RXV5|A0A0L0RXV5_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE55227.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_01141 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MEPILHQLHPAFYPLHRILLETQDLGTVVDGAIKLPPYPLPSTSERLERNGVYVLFDGVG
MYLWVSRHADPTLLAGLFGNSIQSYDQVPSGPIVLQPTGHAYAERALNLINTWRARALQN
STIWPKVHVVKEDADPILRMWTLGLLIEDRAEYAPSFPQFLAQLREKVAAYS
Download sequence
Identical sequences A0A0L0RXV5
AMAG_01141T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]