SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0SQK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0SQK2
Domain Number 1 Region: 137-188,229-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000373
Family Ankyrin repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 458-546
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000641
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0SQK2
Sequence length 590
Comment (tr|A0A0L0SQK2|A0A0L0SQK2_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE64630.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_09986 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MPFSRMNRWQSHSCIPCRHCNPRSHPVLSRPTSRAAMSDSNSSNSNIIYSTDSALTVVDS
STQPPTPASLPTLPVELIEEILVQFVVVHYSRTPTSHLLRGSGDDAVERELRQYLLVTRN
LMLLQRAVLVRFPGCAVHIAVAEGRLDRLRARFAIDSVVDLDSVSKSGALELACERGDVA
VLQWLLDHTNSKRTLLLMRPFSKVALVAAAVRNDLSFCDWWFGRIERFAVRGTMAAALDA
AAEHGHMVVLEWWLHTGFPFTKLASRFVRPASARGRVDVLEWMVQAGLPIRYCNDAMDYA
SANGHIDVLEWWRDAGARPRRLVRSLPYQAPMCKASANGHIHILDWWWGLLGGKLSDQDR
DYGVVAASKHGQLDALDWWFAKEECLPGRSTVAMNWALNGALYNNHVAVLERWKRRVVES
HATVLENAQYVDQTTNASPFPPPSWWVDCGFVCNHWPTTADMAKASEKGSIDAMRWWIAH
KLPFIHTPRGINSASANGEVAVLDWWLHESGLEPLYTIWAIAGASLGGHVAVLDWWRQSG
LPLKYTHDARVRGLASDKKGVAAWWSADDLPPSAPFSNEWPFRLVNAIKK
Download sequence
Identical sequences A0A0L0SQK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]