SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0SSP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0SSP9
Domain Number 1 Region: 70-188
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.56e-23
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Weak hits

Sequence:  A0A0L0SSP9
Domain Number - Region: 2-97
Classification Level Classification E-value
Superfamily OmpH-like 0.0418
Family OmpH-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0SSP9
Sequence length 191
Comment (tr|A0A0L0SSP9|A0A0L0SSP9_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE65521.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_11139 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MSDYAENLRKHQQAEADLIRLQQQQAAMNAGTWQPEQQQYQQPPQQQYQEPPQQQYQQPP
QQQQRELRGVFMEIVEARNLKDVEVIGDIDPYTVVIYGDQKVKTRAHKDAGVNPQLGDTL
EVAITQGSDELLIELWDSNKYNVLTGDTFIGRARVNISDLRREELLDRWVALNDDDNGAA
GEVHIKFHGRY
Download sequence
Identical sequences A0A0L0SSP9
AMAG_11139T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]