SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0SVG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0SVG3
Domain Number 1 Region: 144-274
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-34
Family cAMP-binding domain 0.000023
Further Details:      
 
Domain Number 2 Region: 278-402
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-31
Family cAMP-binding domain 0.0000904
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0SVG3
Sequence length 408
Comment (tr|A0A0L0SVG3|A0A0L0SVG3_ALLMA) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_11625 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MSDYSIPAELPPILKELAREVLRRQPDDVVQFCADYFHRLLAQQRRTLVDHADDATKSQL
AVTAARAPGNAASSSGVSDPAYASSTDDDFGSDLDEDEDEDADEFEDAPVIPPPVINRGR
RTSVSAESMAPTAHDAPAEKVLIPKTPEQRARIQASIATNFLFRNLDEDQYTDVVDAMAE
KKVAAGEAVIRQGGVGDYFYIVETGTLDVYVARNGVEAKVFDYGPGGSFGELALMYNAPR
AATVTATSDAVLWALDRVTFRRILMDHTSRKRRMYEAFLEEVPLLSSLEPYERHKIADAL
ESVTFEDGETVIKQGDIGDNFYLIEAGDAEVVKVDEHGVEHQMRPLRKGNYFGELALLSD
KPRVATIKAKGKLKCATLGKKAFTRLLGPLAEIMQRNTQNYERYPGEK
Download sequence
Identical sequences A0A0L0SVG3
AMAG_11625T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]