SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0TAL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0TAL9
Domain Number 1 Region: 23-65
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000133
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 
Weak hits

Sequence:  A0A0L0TAL9
Domain Number - Region: 81-127
Classification Level Classification E-value
Superfamily EF-hand 0.000105
Family Polcalcin 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0TAL9
Sequence length 191
Comment (tr|A0A0L0TAL9|A0A0L0TAL9_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE71584.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_16146 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MNGHPAAPGAGAGLPASIAEQVHAAQGYLEAHQIAPVMHRLMALLVYHRPDDPRAFMAQR
LRELHALRVGNTGKAESTHLFTRTDLERVYQLHDPAGHGTMTREQFVQAMTSLGLAPDTY
RVPQHDSMTMAQFVDEGMRAAGAVLLPASGATAGTRPAAPPGAPPKVSTPVRRAGVPGAP
SGRMTSPAAGL
Download sequence
Identical sequences A0A0L0TAL9
AMAG_16146T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]