SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1IYD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1IYD4
Domain Number 1 Region: 114-341
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000012
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L1IYD4
Sequence length 510
Comment (tr|A0A0L1IYD4|A0A0L1IYD4_ASPNO) Uncharacterized protein {ECO:0000313|EMBL:KNG84507.1} KW=Complete proteome; Reference proteome OX=1509407 OS=Aspergillus nomius NRRL 13137. GN=ANOM_008413 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTAITPQNTDKASFNLQIQEWHSIDGFLHDILLTWKIPRDGTDDYIGLQSPIELMNAAPE
FQECPYQAKARLHNMASAVKKVAHIILQRNLEVTLSRPIFEHMLVQCAENFPFCEDVVKA
AAGSGGETSLELLFQYGGESLPITEDVVKAAAGTGGYRCLQFLIRQQGESLPITEEVVKA
AAPFERGLELLIQHRGESLPITEEVVKEATRIGGYKCLQLLLQHRGESLPITEEVVKAAA
RSKGGLELLIQYRGKNLPITEKVVKKAVKIGGYKCLQLLIQHQGESLPITEEVVKAAAGN
AEYRCLELLIQLQGKSLPITEEVVKAAVGARDYRCLKLLIQHRGKSLPITEEVFKAAGNA
EYRRLDLLIQNLGKSLPITEEMLKAAATNTSRHAYDIVYLLLQYRAKSLPITENVLKAAA
ANNSPFGGIITRELIKHRGESLPITEAVVEAAAKNETPKALQALLEYGKNSPPISDNFIK
AVAEHCTPQNLRLLIQYQQKNIPIDEEGKE
Download sequence
Identical sequences A0A0L1IYD4
XP_015405430.1.67048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]