SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1KIA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1KIA5
Domain Number 1 Region: 83-196
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.00000000000000915
Family Elongation factor TFIIS domain 2 0.0067
Further Details:      
 
Domain Number 2 Region: 222-264
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000023
Family Transcriptional factor domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L1KIA5
Sequence length 266
Comment (tr|A0A0L1KIA5|A0A0L1KIA5_9EUGL) Transcription elongation factor S-II {ECO:0000313|EMBL:KNH03815.1} KW=Complete proteome; Reference proteome OX=1314962 OS=Perkinsela sp. CCAP 1560/4. GN=XU18_4891 OC=Eukaryota; Euglenozoa; Kinetoplastida; Perkinsela.
Sequence
MNSKTCNEGENRNCVPSISKERGVYQVGNTSVTTNETRKTNPIINAESEDSVTFAEAFYE
ESLSVNESTKQNSIEKTSIRMSVKLGNTEKNFQEENRKLPPHRAKMRRTLFETLKGFRDV
ELQESFLALDELYEYVNNLEKALQELPQEKILKQFRSIEFNLRDSKNSTLRHAVLRKEIT
PSKLSLMSQSDLANPEIQENRKHALQDRLERADTKNHKLDHGKGFFSCRRCGKRETTFVE
LQTSSGDEPSTKFVTCQSCGLNWKFR
Download sequence
Identical sequences A0A0L1KIA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]