SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1LV28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1LV28
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.49e-23
Family SMI1/KNR4-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L1LV28
Sequence length 147
Comment (tr|A0A0L1LV28|A0A0L1LV28_9BACI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KNH20037.1} KW=Complete proteome OX=86664 OS=Bacillus flexus. GN=ACS78_18635 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MNLNAFGQATEESIGELEELLGFLLPEDYKKFLVEYNGGTSKVRYSKFFVEELNQEIPLD
VLYGIGVTRTFDLIKCYEEFEEDMLPYSLVIGDDPGSGLIVLITDTERHGVYYWDHSLSF
PQSREEENTYKVAHSFKDFLDELIHPR
Download sequence
Identical sequences A0A0L1LV28 A0A2B0JDX8
WP_050690666.1.54970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]