SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6FXQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6FXQ5
Domain Number 1 Region: 101-228
Classification Level Classification E-value
Superfamily OmpA-like 4.71e-35
Family OmpA-like 0.00046
Further Details:      
 
Domain Number 2 Region: 70-101
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000111
Family TSP type-3 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L6FXQ5
Sequence length 230
Comment (tr|A0A0L6FXQ5|A0A0L6FXQ5_9PSED) Membrane protein {ECO:0000313|EMBL:KNX79723.1} KW=Complete proteome OX=1478142 OS=Pseudomonas sp. 250J. GN=DA83_14740 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSIVRTAIPLVLLTSVLTGCAGLQKTDWPKCAAVGGVGGAALGAIESSSWAGWGALLGGG
LAAGYCWAHGDGDEDGDGVPDSRDKCPGTPRGVQVDANGCPPEPAPVVEEVVVQKEEVIV
IRDVHFEFNSASLTLKDKDRLDKVASRLKQEAPSARLSVTGHTDSVGSDSYNQKLSERRA
QSVTNYLVESGVPRASFISVGGSGETQPVADNATADGRAMNRRTEIKIQR
Download sequence
Identical sequences A0A0L6FXQ5
WP_050704044.1.76148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]