SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6JJI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6JJI1
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000746
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L6JJI1
Sequence length 54
Comment (tr|A0A0L6JJI1|A0A0L6JJI1_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KNY25895.1} KW=Complete proteome; Reference proteome OX=398512 OS=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933. GN=Bccel_1155 OC=Pseudobacteroides.
Sequence
MFIFGSDGGGEAYAFDTRYNELPIVNIPFIGMSVEVAERIGNTFVEFLEYLEKQ
Download sequence
Identical sequences A0A0L6JJI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]