SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6JSC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6JSC4
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-17
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L6JSC4
Sequence length 159
Comment (tr|A0A0L6JSC4|A0A0L6JSC4_9FIRM) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:KNY28312.1} KW=Complete proteome; Reference proteome OX=398512 OS=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933. GN=Bccel_3586 OC=Pseudobacteroides.
Sequence
MEIKENRIIEPLPSKELVDLNEEYLNVKFPSSFREFIMKYNGGVPKTNLFKYNNHVYVID
RFLCMLEKSSSHKYGEYDINAVCTMLDARLIYDEDLIGYELVPIAVLFAGNFLVLNFHEN
AEEPTICIWSSEESANLKPKVYEVSKSFEEFLTSLYSND
Download sequence
Identical sequences A0A0L6JSC4
WP_036938508.1.39137 WP_036938508.1.73063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]