SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6UYT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6UYT5
Domain Number 1 Region: 197-307
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000218
Family Glutathione S-transferase (GST), C-terminal domain 0.0084
Further Details:      
 
Domain Number 2 Region: 339-370,455-591
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000353
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L6UYT5
Sequence length 646
Comment (tr|A0A0L6UYT5|A0A0L6UYT5_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNZ53721.1} KW=Complete proteome; Reference proteome OX=27349 OS=Puccinia sorghi. GN=VP01_3156g2 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MIEVLSGNLPWLVVALRPDASLWSAGSSGPLERAQGNQSSSAMPRNSSAMPRNSSTMPRS
ISTSNGEPSSSNYNHHHQRTPDPSRSQSENTASSSGTTTTAPGDGHVHPELILVGDQSRS
RQSIQSCPFTFYSAYTLCPAGKKHRVSVSGQKIEATEAQKSLDATATIPTQYLPFIIYRG
TAVAGGSVNLIQFLEDAFPDHHPRLFSSDLIERARERLWSDYIRQYAVPLFVRALRARVT
FHRCDSTTIAGLGKVLNNYCESCIGPFFSGEQLSLPDILIAPFIFQTKLNAFPRLVTAAS
TLVDSGAGARYQNYADQLLKCQSLKEVLSKSEVSIENLGIQIQAMSRRITPSVPALPPEI
VTHIIDELGDYELAETLEVAHHIPPTSAWLELATPLDRAILSGRLARVTEAYTSHKHTRL
STWGARVMVRFGYITMLDFLLSVESDQLHQLCDHLLPDVASAWERVNVLEWALHEGFGIL
SDASESAINEASMNGHLAVLDWWKGSGLPLKIGNVMDYASLESTTISLEWWARSGLEGKY
SRMALLNATNQGHLKVLDWWLNSGLQLVYDKDILVGATKYGKVESLEWWLKSKLKVAYTI
FDIEEAIEDCTNRQLEVHEWWKQQGLDQAGSAIDWTETKFLGNTRA
Download sequence
Identical sequences A0A0L6UYT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]