SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6W9P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6W9P0
Domain Number 1 Region: 2-124,159-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-29
Family Nucleotide and nucleoside kinases 0.00014
Further Details:      
 
Domain Number 2 Region: 124-160
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000000877
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L6W9P0
Sequence length 269
Comment (tr|A0A0L6W9P0|A0A0L6W9P0_9AGAR) Adenylate kinase 2 {ECO:0000313|EMBL:KNZ71799.1} KW=Complete proteome; Reference proteome OX=1306850 OS=Termitomyces sp. J132. GN=J132_07288 OC=Termitomyces.
Sequence
MLMFGKPGAGKGTLSARLVDKYDILSLSSGDLLRQHIAEGTEVGREAEETVARGGLLPDE
VMLKVITSNLDSLHNKHWILDGFPRTLGQAKLLDHHLKKKNTSLTFVVNIDVPDEIILSR
ISDRWIHLPSGRVYNMSYNPPKMEGYDDITGEPLTKRPDDNPEVFTRRLTQFYASTSPLL
DYYTQAAKSTTTHTRNSHQHPHQLTFHRPEKVVLKTLEGATSDENWLVLDRAIRFAFPAL
KERSSLRDRRRSDLNDAIFTDQVGAGLQS
Download sequence
Identical sequences A0A0L6W9P0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]