SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6ZCD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6ZCD7
Domain Number 1 Region: 48-89,120-182
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 2.75e-23
Family Bacterial S-adenosylmethionine decarboxylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L6ZCD7
Sequence length 269
Comment (tr|A0A0L6ZCD7|A0A0L6ZCD7_9CLOT) S-adenosylmethionine decarboxylase alpha chain {ECO:0000256|HAMAP-Rule:MF_00465} KW=Complete proteome; Reference proteome OX=1121318 OS=Clostridium homopropionicum DSM 5847. GN=CLHOM_07860 OC=Clostridium.
Sequence
MEKHGKNKIKLYGFNNLTKSLSFNIYDICYTKTEEDRKKYIEYIDEQYNSERLTRILTNV
TEIIGASVLNVAKQDYDPQGASVTLLISEEEVPLYVLDPSCNRGIITPIRENIVGHLDKS
HVTVHTYPESHPQNDLSTFRVDIDVSTCGTISPLKALNYLIGSFDSDIITIDYRVRGFTR
DVDGEKHFIDHKINSVQNYISEETINRYNFIDMNIYQSNIFHTKMKLRDLDLSNYLFEIK
EEDLSEDEKKVILDKLNKEMTEIFYGINI
Download sequence
Identical sequences A0A0L6ZCD7
WP_052220376.1.55619 WP_052220376.1.63904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]